5384681 - polygon5

Score: 0.009

+ 4 fingers	108466
+ after orgasm	5861
+ animal genitalia	490772
+ animal penis	344791
+ anthro on anthro	183910
+ anthropomorphism	3513319
+ arms bent	3479
+ balls	1102870
+ big eyes	17657
+ big penis	217821
+ biped	406809
+ black text	9859
+ bodily fluids	1529928
+ buckteeth	51031
+ character:mitzi (ajmarekart)	84
+ child	29134
+ creator:polygon5	556
+ cum	785639
+ cum covered	6703
+ cum in hair	9236
+ cum leaking	38628
+ cum on body	167247
+ cum on chest	22464
+ cum on eye	343
+ cum on face	95932
+ cum on ground	25630
+ cum on hand	10438
+ cum on hands	9145
+ cum on leg	19803
+ cum on lower body	49123
+ cum on tongue	17312
+ cum on upper body	59169
+ curled tail	8144
+ disembodied penis	63673
+ duo	1587288
+ ellipsis	19254
+ equine genitalia	34649
+ equine penis	146245
+ erection	930379
+ extended legs	386
+ eyelashes	268563
+ face	968383
+ facial expression	888113
+ fellatio	195430
+ fingering	54347
+ fingering self	11269
+ fingers	457629
+ flat chest	54890
+ flat chested	29161
+ gender:female	2911146
+ gender:male	2729583
+ genital fluids	1100117
+ genitalia	2293958
+ genitals	2095251
+ grabbing	175782
+ grey heart	34
+ hair	1862791
+ hand on face	8210
+ hands on own face	263
+ heart	205313
+ heart symbol	345315
+ humanoid hands	101754
+ interspecies	343650
+ iris	4680
+ kneeling	148160
+ large penis	348668
+ laugh	10898
+ laughing	11723
+ leaking	52862
+ leaking cum	21956
+ legs	324333
+ loli	56015
+ long eyelashes	4593
+ looking at another's penis	195
+ looking at genitalia	15418
+ looking at penis	15741
+ looking at viewer	968953
+ looking down	77379
+ looking down at penis	350
+ looking pleasured	197232
+ looking up	41417
+ looking up at penis	32
+ male/female	713555
+ masturbation	183946
+ medium:digital drawing (artwork)	141209
+ medium:digital media	1040049
+ medium:english text	665783
+ medium:greyscale	116776
+ medium:high resolution	3015857
+ medium:monochrome	369789
+ medium:simple background	1295606
+ medium:text	1032448
+ medium:white background	349860
+ messy	51215
+ meta:2024	102365
+ meta:digital drawing (artwork)	98028
+ meta:digital media (artwork)	544905
+ meta:english text	351682
+ meta:greyscale	24661
+ meta:hi res	1860297
+ meta:monochrome	126440
+ meta:sequence	10867
+ narrowed eyes	277673
+ navel	466737
+ nipples	1299110
+ no pupils	10298
+ nude	1377000
+ nude anthro	12259
+ nude female	44003
+ one eye closed	137003
+ one eye half-closed	1399
+ open mouth	995503
+ open smile	110781
+ oral	333198
+ penile	459405
+ penis	1693421
+ penis awe	3739
+ penis grab	13555
+ penis in mouth	9119
+ pussy	903808
+ pussy juice leaking	1996
+ rating:explicit	2917724
+ round ears	4440
+ series:murphy and mitzi	182
+ sex	1122831
+ short hair	152130
+ sitting	337431
+ smile	1090269
+ smiling at viewer	32335
+ species:equid	203522
+ species:equine	457006
+ species:mammal	3597168
+ species:rodent	152957
+ species:sciurid	39520
+ species:tree squirrel	20624
+ spread legs	320662
+ spreading	386176
+ standing	418352
+ straight legs	907
+ tail	905132
+ teeth	588884
+ text	858074
+ tongue	910804
+ tongue out	584204
+ vagina	1028268
+ vaginal	434134
+ vaginal fluids	16715
+ vaginal masturbation	33510
+ white background	189129
+ wide eyed	16393
+ wide-eyed	23457
+ year:2024	64815
+ young	283235
+ young anthro	13451
+ young female	8419

Post History

Find on

Fullsize Shrink to fit

image/png

541.73 kiB

2024-06-20 08:54:21

Find Similar Download

ID	5384681
CID	bafybeibggcrpldyoth6tpn2z46mbhp4atsfoxo4rfibxu2dsfuldccl3yq
Sha256	05293526ac0168bf73c56e4c84007b2e88e0c4486eda2adea382e67170ce1806
Md5	db3a5a12ec3640530b3fe7aa33ad7dca

Thumbnails
256	bafkreiedndrwseieqkamrvceikvrtlqn5d5ohlolnw7lezvphfkwzrn6bm
512	bafkreib2aa7gczta43gozx37kn2psdfjl6vdaqh7j5d7hph3vfpnpjmzte
1024	bafkreie2isx7am6wixfc7g2vhb37hqtnvluirjomb22bvh3k6vup22hhia

Page generated in 0.0645s